Skip To Main Content
Wenkang Chen on Muck Rack

Wenkang Chen

As seen in: MDPI, BMC Genomics, medRxiv
Is this you? As a journalist, you can create a free Muck Rack account to customize your profile, list your contact preferences, and upload a portfolio of your best work. Claim your profile

Get in touch with Wenkang

Contact Wenkang, search articles and posts on X, monitor coverage, and track replies from one place.

Learn more about Muck Rack

Actions

Share this page

Is this you?

As a journalist, you can create a free Muck Rack account to customize your profile, list your contact preferences, and upload a portfolio of your best work.
Claim your profile

Articles

Pan-WD40ome analysis of 26 diverse inbred lines reveals the structural and functional diversity of WD40 proteins in maize - BMC Genomics

|
By Pengfei Yin, Tao Li, Xiaoxia Du, Wenkang Chen, Renyu Zhang, Xiaohong Yang, Xuan Zhang, Shenghui Ji
| BMC Genomics
To identify WD40 genes in 26 maize NAM founders, we performed a local BLASTP search using the consensus protein sequence GECKXVLXGHTSTVTCVAFSPDGPLLASGSRDGTIKIWD, which is characteristic of the WD40 domain in eukaryotes, then confirmed the presence of this domain using Pfam. We identified 6849 genes containing the WD40 domain across the NAM founders, with gene number per founder ranging from 252 (Ms71) to 277 (Oh43) (Fig. 1A; Table S1).
Open in Who Shared Issue with article?

Heterogeneous Hierarchical Fusion Network for Multimodal Sentiment Analysis in Real-World Environments

|
By Ju Huang, Wenkang Chen, Fangyi Wang, Haijun Zhang
| MDPI
All articles published by MDPI are made immediately available worldwide under an open access license. No special permission is required to reuse all or part of the article published by MDPI, including figures and tables. For articles published under an open access Creative Common CC BY license, any part of the article may be reused without permission provided that the original article is clearly cited. For more information, please refer to https://www.mdpi.com/openaccess.
Open in Who Shared Issue with article?

Evaluation of the diagnostic value of YiDiXie™-SS, YiDiXie™-HS, and YiDiXie™-D in Ovarian cancer

|
By Pengwu Zhang, Chen Sun, Zhenjian Ge, Wenkang Chen
| medRxiv
The authors have declared no competing interest. ChiCTR2200066840 This work was supported by Shenzhen High-level Hospital Construction Fund, Clinical Research Project of Peking University Shenzhen Hospital (LCYJ2020002, LCYJ2020015, LCYJ2020020, LCYJ2017001). I confirm all relevant ethical guidelines have been followed, and any necessary IRB and/or ethics committee approvals have been obtained.
Open in Who Shared View Duplicates (25) Issue with article?
See all 5 articles